ISAzo25

  • Family IS1182
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006513 ND Azoarcus sp.
Aromatoleum aromaticum EbN1
Azoarcus sp. EbN1
DNA section
IS Length : 1388 bp

Ends


IR Length : 9/11

IRL : GAGTTCTGGTAGCGGCAGCCTGTTATTGACACTCGAGCCTCTTGCAAAAG
IRR : GAGTCCTGCGTCATCGACGGCAAGGGTGTCAGGGCAGGCGTTGAGGTGCG

Insertion site


Left flankDirect repeatRight flankDR Length
CTCCGGCGCGGCTCCGTCCA0

DNA sequence

GAGTTCTGGTAGCGGCAGCCTGTTATTGACACTCGAGCCTCTTGCAAAAGGAGCTCTGCACGGGGGATTTTTTGCGGCGGGAGGCAAAGGCGGAGGGTGC
GGGCGGCCATTTCTGGCATGATGCGGTTATCGAAGCCAACATCATAACGCCCGCCCCATGGATGCTATCCGACGCGAACTGATCCTGCAACGCTGGAACG
TGATTCAGCACGAACTGCTGCCCGAGTTGAAGAACGAGGTGGGCGCGCTGACGCCGAAGCTGGAGAAAGTCATCCACACCCTGGAATGGGTGCGCATCGA
GGAATTCACGGCGTCGACATGGTGTCGGGTGGGGCGTCCGCCCTGTGAGCGGGCCTGGCTGGCGAACGCTTTCGTCGCGAAGGCGGTGCTGGGACTGACG
ACCACGGTGGGGCTGATCGAGCGCCTGACGGTGGATCGTGCGCTGCGGCGCATCTGTGGTTTCCCGCTGTGCCGCAAGCTGCCCTCCGAAGCCACGTTCT
CGCGCGCGTTCGACGAGTTTGCCGCGGCGCGTCTGGCCGAACGGGTGCATGAGGCGCTCATCAAGGAACACCTTGGGGATGAACTGATCGGGCACCTCAG
CCGCGATGGCACCGCGATCGAAGCGCGCGAGCGCCCGGCCCACACCAGGGGTGCGGCGGCGACACCGGCGCCTGCGGCCCAATCGTCCCTGAGCATCGAG
GAAGAAACCGCCGCGCCAACGCCACCGGTGCCGGCGAAGAAACGCGGCCGCGGCCGCCCCCGGCGCGGCGAAGTCCGTGCCCCCGCCAAGGTTTCGCCCA
TCCAGCGCCAACGCCAGCAGCGCCTAGCGCAGAGGCTCGAGGACATCCCCACGGTGTGCGACCGCGGCACCAAGTGCAATGCCCAGGGGTACAAAGTCAG
CTGGAACGGCTACAAGCTGCACCTGGACACCGCCGACTGTGGCGTGCCGATTGCGGCGCTGCTGTCGTCGGCCTCGATGCACGACAGCCGCGCCGCCATC
CCCCTGTCGCTGATCAGCGCTCAGCGCGTCACCAACCTCTACGACGTCATGGATGCCGCCTACTGCAGCTTCGCGTTGCATGAGCACTGCCGCAGCCTCG
GCCATGTCCCCTTGATCGACCACAATCCGCGCGGCGGCATGAAGGAGGAGTTCGAGCCTGCCGACGCGATCCGTTACAACGAACGCACCGTCGCCGAGCG
CAGCAATGCACGGCTCAAGGATGAGTTCGGCGGCAACACCGTCCGCGTCAAGGGCGGCACCAAGGTCATGGGACACCTGATGTTCGGTGTCCTGGCGCTG
TCTGCCGATCAGTTGATGCGATTGCGACAATGACACGCCGCACCTCAACGCCTGCCCTGACACCCTTGCCGTCGATGACGCAGGACTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1095 bp364 aa2391333+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VGALTPKLEKVIHTLEWVRIEEFTASTWCRVGRPPCERAWLANAFVAKAVLGLTTTVGLIERLTVDRALRRICGFPLCRKLPSEATFSRAFDEFAAARLA
ERVHEALIKEHLGDELIGHLSRDGTAIEARERPAHTRGAAATPAPAAQSSLSIEEETAAPTPPVPAKKRGRGRPRRGEVRAPAKVSPIQRQRQQRLAQRL
EDIPTVCDRGTKCNAQGYKVSWNGYKLHLDTADCGVPIAALLSSASMHDSRAAIPLSLISAQRVTNLYDVMDAAYCSFALHEHCRSLGHVPLIDHNPRGG
MKEEFEPADAIRYNERTVAERSNARLKDEFGGNTVRVKGGTKVMGHLMFGVLALSADQLMRLRQ

 

Blast result :
Comments
ISAzo25 is 44% aa similar to IS656.
Position of the ends of ISAzo25 could not be precisely determined.
References
1] Kuhner,S., Wohlbrand,L., Fritz,I., Wruck,W., Hultschig,C., Hufnagel,P., Kube,M., Reinhardt,R. and Rabus,R. (2005) J. Bacteriol. 187 (4), 1493-1503.

2] Rabus,R., Kube,M., Heider,J., Beck,A., Heitmann,K., Widdel,F. and Reinhardt,R. (2005) Arch. Microbiol. 183 (1), 27-36.

3] PROSCIENCE (2004) Direct Submission GenBank.

4] ISfinder annotation (2008).