ISAba3

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY665723 ND Acinetobacter baumannii
Acinetobacter baumannii MAD
DNA section
IS Length : 800 bp

Ends


IR Length : 21/24

IRL : GGTAGTGTTTCAAAAAGTATGCTGAAGAAAAAGCCGATTGGATTTTGATA
IRR : GGTGGTGCTTCAAAAAGTATGCTGCCTTTAAATGAAGCCATTATTGATGT

Insertion site


Left flankDirect repeatRight flankDR Length
CTTAACATAAAATTTTAAAAATAGATTAACCT0

DNA sequence

GGTAGTGTTTCAAAAAGTATGCTGAAGAAAAAGCCGATTGGATTTTGATAAAATAGAGAAATGCAAATAACTCTAGCAATCAAATGTCCAACCTGCCTCA
GTGATAGTATAAAGAAAAATGGTATCAAAGTAGATGGGAAACAAAACTATCAGTGCAAAGACTGTAAACGTCAGTTTATTGGTGATCATGCACTGAGCTA
TCTAGGATGTAAGTCAGGTATTACTCGTAAAATATTACAGTTGATGGTCAGAGGCAGCGGTATACGAGATATTGCTGAAGTTGAGCGCATCAGTATCGGT
AAAGTTTTACGTACTTTAACTGAATCAACCTATGAAATTCAGCCTCAGCAAAGTCATTATGAATCTCTCGAAGTAGATGAGTTCTGGAATTTTGTTGGAA
ATAAAAAGAATAAACAATGGCTTATTTACGCCTATCATCGAGAAACAGGTGAAATTGTTGCTTATGTTTGGGGTAAACGAGATTTAGCTACTGTCTAACA
ATTGAAGACAAAGCTTAAACAATTAGATATTCACTACACCCGAATTGCAAGTGATCATTGGGACAGTTTCATCACTGCTTTTAAAAATGGTAAGCAAAGT
ATTGGTAAATTTTTTACTGTAGGCATTGAAGGCAATAATTGCAAAATAAGGCATAGAATTAGGCGTAGCTTCAGAAGAAGCTGTAATTTTTCGAAAAAGC
TTGAAAACCATTTTAAAGCTTTTGATTTAGCCTTCTTTTCTTTTACATCAATAATGGCTTCATTTAAAGGCAGCATACTTTTTGAAGCACCACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
735 bp244 aa61795+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQITLAIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHALSYLGCKSGITRKILQLMVRGSGIRDIAEVERISIGKVLRTLTESTYEIQPQQSHY
ESLEVDEFWNFVGNKKNKQWLIYAYHRETGEIVAYVWGKRDLATV*QLKTKLKQLDIHYTRIASDHWDSFITAFKNGKQSIGKFFTVGIEGNNCKIRHRI
RRSFRRSCNFSKKLENHFKAFDLAFFSFTSIMASFKGSILFEAP

 

Blast result :
Comments
The transposase does not appear to require a frameshift as other IS1 family members. There is a termination codon which interrupts the single Tpase orf. The orf carries all the expected IS1 signatures (see Ton-Hoang et al., 2004)
ISAba3 is 57% aa similar to ISEhe5.
References
1] Poirel Laurent. (2004) Direct submission
2] Poirel L, Marqué S, Héritier C, Segonds C, Chabanon G, Nordmann P (2005). Antimicrob. Agents Chemother., 49 :202-208.