ISAtu1

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AF242881 ND Agrobacterium tumefaciens
Agrobacterium tumefaciens plasmid Ti
DNA section
IS Length : 1316 bp

Ends


IR Length : 11/13

IRL : tatgggATGGACGCCTCCCTCCGAACTGGCAGAGTAAAGGGCCAACCAAA
IRR : ---tctATAAACGCCTCCCGGGCGAGAAGAACATTTGGCGGCAACTCGGC

Insertion site


Left flankDirect repeatRight flankDR Length
GTCTTCATGCTTATCGTAAT0

DNA sequence

TATGGGATGGACGCCTCCCTCCGAACTGGCAGAGTAAAGGGCCAACCAAAGGAGGAAGTCATGACGTATGAATTGCTCGCAATCGATCTTGGAAAGTTGT
CCTTTCACCTGCATAGCACAGCATCGCTGCAGATGGAGCCGTTCTTTCCCGCAAAGTCAGCCGGTCGAAGTTGGCCGAGACTATAAAAGCGATTTCTCCG
AAGACAATAGCAATGGAAGCCTGCGCCAGCGCTCATCATTGGGGAAGACAGTTCAGGCAAGCAGGACGAGAAGTCCTTCTCATCAATCCACGCTTCGTGA
AGCCATTTGTACGCGGCTCCAAGAACGATGCGGTCGACGCAGCGGCGATATATGAAGCTGCGACACGGCCAACCATGCGGTTCGTACCGGTTAAGTCTAC
CGCGCAGCAAGATCTTCAGTCGCTACATAGAATTAGAGAGCGTCTCATTATCCAGCGCACATCGCTTTTCAATCATGCGCGTGGCCTTCTCGCCGAATAT
GGGATCGTACTGCCACAAGGACCGTGGAACTTCGCAGCCCAGGCACCCTCGGCGGTCGAGAATGCACCTCAGTCGGATCTTGGGCGTGAGCTATTCCTGG
AACTTCTTGATCAATACCGAGTTGAATGGCCGCGTATCAGGATCGATAGGAAGATCAGTGAGATTTGCCGCGAACGAGACGATTGCCGTCGTCTCTCCGA
GTTGCCAGGCATTGGCCCGATCATTGCGACTGCATTGGTGGCGAGTGTCGAAGATGGGCGCCATTTTAAATCAGGGCGAGAACTGGCAGCACGGATCGGG
CTGGTCCCGCGACAATATACGACCGGCGGCAAACCACGCCTCGGTGGAATTGGCCGCCGAGCGAACCACTATCTCCGTCGACAGATGATTCATGGCGCCC
GCGCAGTTATCAGCCGACTTGCTAGTCACCATGATCGCCGATCTCAGTGGCTGGAAGAGCTCGTCGTTCGCAGGGGATTTAATAAAGCGATTGTGGCACT
TGCCAACAAGACCGCGCGGATAGCATGGGCTCTGCTTACCCGACAGGAGCGTATGCCGCACAATAGCCATTTACCAATCGTTGCCTATTAGGCGATGGTG
AATGCGAGGTAAGAATTGATGGCGTAACGGCACCGACCGCGCTTCGGATCCTGATTTACGACAAGGCCACTCAGGTCGATCATGTTATGAGGACAGAGGT
AGCGGACTCCCATCAAGGCCACGAGCGTGATCGCTCCAGCGATAGGCCGGATAGATTCACACATCCAATGCCGAGTTGCCGCCAAATGTTCTTCTCGCCC
GGGAGGCGTTTATAGA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
951 bp316 aa1411091+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

VLSRKVSRSKLAETIKAISPKTIAMEACASAHHWGRQFRQAGREVLLINPRFVKPFVRGSKNDAVDAAAIYEAATRPTMRFVPVKSTAQQDLQSLHRIRE
RLIIQRTSLFNHARGLLAEYGIVLPQGPWNFAAQAPSAVENAPQSDLGRELFLELLDQYRVEWPRIRIDRKISEICRERDDCRRLSELPGIGPIIATALV
ASVEDGRHFKSGRELAARIGLVPRQYTTGGKPRLGGIGRRANHYLRRQMIHGARAVISRLASHHDRRSQWLEELVVRRGFNKAIVALANKTARIAWALLT
RQERMPHNSHLPIVAY

 

Blast result :
Comments
ISAtu1 is 78% aa similar to ISMtsp7.
The IRs are not at the termini of the IS.
This IS is inserted into an IS21 family member.
References
1] Zhu et al. unpublished
2] Partridge and Hall (2003) J. Bacteriol. 185, 6371-6384