ISA0963-7

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AE000976 ND Archaeoglobus fulgidus
Archaeoglobus fulgidus
DNA section
IS Length : 963 bp

Ends


IR Length : 20/26

IRL : TGTAGTATCCCGAAATAACTTCACACCCCAACAAGATTGCCACGTGAGGA
IRR : TGTGGTATCCCAAATTATATTTACACTTTCCCTTCAATCCCACCACCTCC

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TGTAGTATCCCGAAATAACTTCACACCCCAACAAGATTGCCACGTGAGGAAGCTAACAAACAAGGACATACTCAGAATAGTGAAACAGTGGCTGAAAGGA
AAGCCGATAACAAAGATAGCAGAGTTCTTTCAGGTGACAAGGCAGAGAATCCATCAGATAATCAAACACTTCAAAGAAACTGGTGAGATTCCCTTCCTGA
AGAAACCGGGAAGAAAACCCAAGGAAATTGACGAGGAAACAGAAAGAATAATCCTGGAAGCACACAAAAGGTTTAATCTCGGTCCAGTTCACTTAGAAAA
GAGAATAGAGGAAGAGTACTGCATTCACATCCCCCACAACACGATCTACAAGGTTTTACTCAACCAAGGTTTGGTGGAGGAGAACATGAAGAAGAAAAAG
CAGCGGAAGTGGGTTCGCTATGAAAGAGATCACTCAATGTCTTTATGGCAGGGAGACTGGAAGAGGTTGGAGAGAAGTGGATAATCGCTTTCATGGACGA
TGCTTCCCGCTTCATCACCTGCTATGGAGTATTTGACTCTGCTACTACTGAGAACACAATCAAGGTGCTCAAGAAAGGATTCGCTGAGTATGGCATTCCG
GATGAAATCCTCACAGACCATGGTACCCAATTTGTTGCAGCGAAAAGCAGAGAGAAGGCTAGGCACAGATTCAGGGAGTTTTTGGCCGAGAATGGAGTAA
GGCACATTCTTGCGAGAGTGAACCATCCACAAACGAATGGGAAGATAGAGAGGTTCTTTGGAGAGGTTGAAAGAAGAGCTGGAAAGTTTGGCTCAGTTGA
TGCTGTTGTAAGATGGCATAATGAGATTAAGCCTCATAGAAGTTTGGACTGGGATGAACCTTGCAATGTGTTCTGGTACAAGCTTCCTCCAGAGAGAGTT
ATGTGGTTTGTGAGGAGGTGGTGGGATTGAAGGGAAAGTGTAAATATAATTTGGGATACCACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
887 bp295 aa44930+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VRKLTNKDILRIVKQWLKGKPITKIAEFFQVTRQRIHQIIKHFKETGEIPFLKKPGRKPKEIDEETERIILEAHKRFNLGPVHLEKRIEEEYCIHIPHNT
IYKVLLNQGLVEENMKKKKQRKWVRYERDHSMSLWQGDWKRLEEKWIIAFMDDASRFITCYGVFDSATTENTIKVLKKGFAEYGIPDEILTDHGTQFVAA
KSREKARHRFREFLAENGVRHILARVNHPQTNGKIERFFGEVERRAGKFGSVDAVVRWHNEIKPHRSLDWDEPCNVFWYKLPPERVMWFVRRWWD

 

Blast result :
Comments
There is a frameshift +1 at position 472 . When "corrected" this extends the ORF and its similarity to the others members of the family.
ISA0963-7 is 82% aa similar to ISA0963-1, ISA0963-2, ISA0963-4, ISA0963-5 and ISA0963-6, 81% to ISA0963-3, 43% to ISBst1 and ISVch1, 38% to IS5564, 36% to Is1122 and IS1121.
References
1] Klenk,H.P., Clayton,R.A., Tomb,J., White,O., Nelson,K.E., Ketchum,K.A., Dodson,R.J., Gwinn,M., Hickey,E.K., Peterson,J.D., Richardson,D.L., Kerlavage,A.R., Graham,D.E., Kyrpides,N.C., Fleischmann,R.D., Quackenbush,J., Lee,N.H., Sutton,G.G., Gill,S., Kirkness,E.F., Dougherty,B.A., McKenney,K., Adams,M.D., Loftus,B., Peterson,S., Reich,C.I., McNeil,L.K., Badger,J.H., Glodek,A., Zhou,L., Overbeek,R., Gocayne,J.D., Weidman,J.F., McDonald,L., Utterback,T., Cotton,M.D., Spriggs,T., Artiach,P., Kaine,B.P.,Sykes,S.M., Sadow,P.W., D'Andrea,K.P., Bowman,C., Fujii,C., Garland,S.A., Mason,T.M., Olsen,G.J., Fraser,C.M., Smith,H.O.,Woese,C.R. and Venter,J.C. (1997) Nature 390 (6658), 364-370