ISCosp2

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_LJVG01000078 ND Colwellia sp.
Colwellia sp. MT2012
DNA section
IS Length : 1054 bp

Ends


IR Length : 19/20

IRL : AAGGGGTATCCCTTTAGCTCCACAAGACGTAAAGTGTTCTTATGGAGCCA
IRR : AAGGGGTATCCCCTTAGCTCCATATATGAGGTTTTGTATTATTCTCAACT

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNAT0

DNA sequence

AAGGGGTATCCCTTTAGCTCCACAAGACGTAAAGTGTTCTTATGGAGCCAATCAAAAAAATGCCTGTCGCTGGCAAAGACTACCCTATAACTTGGAGCCA
ATTTCTTGATTGGTTTCATTCTGAAGAATCTTGCCGGACTTATTTGGTTGGTTTGAGGTGGCCTACTGGATTTATTTGCCCAAAGTGTGGTTTTTTGGGA
AATGTTACGCAATCAAGTCGAGGTAGATGGGTGTGTCCCGCCTGTAAACGCCAGTCCACAGTTACGGCGGGTACGATCTTTGACAAGACACGCACTGATA
TACGAGTCTGGTTTGCTGCAATTTGGTATATCACGAGCCAAAAAAATGGGGTGAGTGCGCTTGGATTACAACGAGTTTTGGGACTTGGAAGTTACGAAAC
TGCTTGGACGATGCTGCACAGATTACGACGAGCAATGGTACTTCCATCTCGTGAATTGCTGACAGGAGAAGTTGAAGTTGATGAAACTTACCTAGCTTTA
ACAGAGCGTGGTAATCATAAATCTGGCAAGAGTAGTAAGTGTAATACAACGAAGGCATTGGTTGTTATTGCTGTAGAAATACTTCAACCAAAAGGCTTCG
GTAGAATTCGTGTTCAACGTATTGAAAAAGCAGATTCAGCACACTTGATACCGTTTATCTGGGAGTCAATTGATGCAAGTGCGAATATTCACACTGACGG
CTCAACAGCTTATAACAAGCTCAAAGAGAAAGGATACGATCATCGGCGAACGGTTCATCTGGGTTCAGATATTCAGGCTCATGATTCCATGCCTGGCGTT
CATCGAGTTGCAGCTCTTCTTCAACGGTGGCTACTAGGGACTCATCATGGTGCTATACAGCCCAAACAACTCGATTATTACTTAGATGAGTTTGTCTTTC
GTTTTAATCGCCGAACTTCAAAATCACGAGGTTTGCTATTTTATAGGTTGCTTCAACAGGCTGTGGTGACTCGTCCAGTTACGTACAAAAAGATCACAGG
TAAGAGTTGAGAATAATACAAAACCTCATATATGGAGCTAAGGGGATACCCCTT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
969 bp322 aa421010+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEPIKKMPVAGKDYPITWSQFLDWFHSEESCRTYLVGLRWPTGFICPKCGFLGNVTQSSRGRWVCPACKRQSTVTAGTIFDKTRTDIRVWFAAIWYITSQ
KNGVSALGLQRVLGLGSYETAWTMLHRLRRAMVLPSRELLTGEVEVDETYLALTERGNHKSGKSSKCNTTKALVVIAVEILQPKGFGRIRVQRIEKADSA
HLIPFIWESIDASANIHTDGSTAYNKLKEKGYDHRRTVHLGSDIQAHDSMPGVHRVAALLQRWLLGTHHGAIQPKQLDYYLDEFVFRFNRRTSKSRGLLF
YRLLQQAVVTRPVTYKKITGKS

 

Blast result :
Comments
ISCosp2 is 83% aa similar to ISMrsp3.
References
1] Thomas Jové (2016) Direct submission.
2] Kyaw,T.S., Ugalde,J.A., Peoples,L., Narasingarao,P., Chastain,R.A., Yayanos,A., Methe,B.A. and Bartlett,D.H. (2015) Direct GenBank submission.