ISCosp1

  • Family IS1595
  • Group IS1595
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LSMS01000228 ND Colwellia sp.
Colwellia sp. Phe_37
DNA section
IS Length : 1033 bp

Ends


IR Length : 18/23

IRL : CCTGATTacccacaataaacagctacgctttccgataaatagtctatatt
IRR : cctgaTTACCCATAAAGCTCAGCCATACTCATTAGCTTGTTCGACATAGG

Insertion site


Left flankDirect repeatRight flankDR Length
ACTTCCATAACATACAATTTAAAAGTAATGAGCTCGGACA0

DNA sequence

CCTGATTACCCACAATAAACAGCTACGCTTTCCGATAAATAGTCTATATTTAATATAAGCGTTAATTGAGGTGGTGAGTCATGAGTAAAAATCAGGTTCA
ATATCAAAAAGGCTATAGTTTACTTGAATTATTTAAGGACTATGGAACAGAAGAACAATGCTCTAAAGCATTATTTAACTGGAAATGGCCTCAAGGTTTC
AGTTGCCCTGAATGTAGCGCTACAAGCTACTGTGCTCTAAAATCTCGAAAAATTTATCAATGTAATCACTGCCACCATCAAACCTCAGTAACGAGCGGGA
CTATTTTTGCTAGCACCAAACTTCCCCTGACGCGTTGGTTTTTAGCAATGCACCTTATTACACAAGCTAAAACGGGGATTTCTTCTTTATCTTTAAAGCG
AGCGTTAGGTGTTTCATATAATACCGCTTGGAGCATGAAACAAAAAATCATGCAGGTGATGAAAGAGCGTGATGATAGCCAACCGTTATCTGGCACTATC
CAGGTTGATGATGCCTATTACGGTGGAGAGCATCGTGGAGGTAAACGAGGACGAGGCTCTGAAAATAAAACGCCCTTTATTGCCGCTGTATCGACGAATG
AAGAAGGGCATCCTATGAAAATGAATTTTACGGTGTTGAAAGGATTTCGTTTAACTGAGATATCAAAATGGTCGAAGAAACATTTATCTAAAGGGAGTGT
GGTTGTTTCCGATGGTTTAGCTTGCTTTAAAGCCGTGACTGAAGCTCAATGCGAGCATTTTTCTATTGTGACAGGCGGTGGGCCAGATAGCGTTAAGAAA
GCACAATTCATTTGGGTAAATACGATGATAGGTAATGTTAAAAACTCTATTGTTGGTACCTATCATGCTATTAAACCTAAACACCTACCTCGTTACTTAG
CAGAATTTAGTTACCGCTTTAATCGACGTTTTCAACTAGAGGATATGTTACCACGATTTGCTTATATTGCTTTGCGAACACCGCCTATGTCGAACAAGCT
AATGAGTATGGCTGAGCTTTATGGGTAATCAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
948 bp315 aa811028+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKNQVQYQKGYSLLELFKDYGTEEQCSKALFNWKWPQGFSCPECSATSYCALKSRKIYQCNHCHHQTSVTSGTIFASTKLPLTRWFLAMHLITQAKTGI
SSLSLKRALGVSYNTAWSMKQKIMQVMKERDDSQPLSGTIQVDDAYYGGEHRGGKRGRGSENKTPFIAAVSTNEEGHPMKMNFTVLKGFRLTEISKWSKK
HLSKGSVVVSDGLACFKAVTEAQCEHFSIVTGGGPDSVKKAQFIWVNTMIGNVKNSIVGTYHAIKPKHLPRYLAEFSYRFNRRFQLEDMLPRFAYIALRT
PPMSNKLMSMAELYG

 

Blast result :
Comments
ISCosp1 is 82% aa similar to ISSbe1.
References
1] Thomas Jové (2016) Direct submission.
2] Dombrowski,N., Donaho,J.A., Gutierrez,T., Seitz,K.W., Teske,A.P. and Baker,B.J. (2016) Direct GenBank submission.