ISCni1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_014749 ND Calditerrivibrio nitroreducens
Calditerrivibrio nitroreducens DSM 19672
Calditerrivibrio nitroreducens DSM 19672 plasmid pCALNI01
DNA section
IS Length : 1253 bp

Ends


IR Length : 20/24

IRL : GGTAGTGTATAATTAATTGTGTCATTGAAATCCCCCTTGAAGGGTTGTAG
IRR : GGTAATGTCAACTTAATTGTGTCAACCATCACCCTTGAAGCATTTTTATC

Insertion site


Left flankDirect repeatRight flankDR Length
CAAAAGATATGGGAGTAGTC0
AATAAAAACACAATTTGTTATTTACTTT8
CCTTTGAATTTTAGATTTTCTTTTTTAA8
TATTTTTAGAATTATTTTCTTTAATTCT8
AAGTTAAATATAGCAATAGTATTGCGGAT9
CAATTCATCAAATCCAAATGTTAGGTTT8

DNA sequence

GGTAGTGTATAATTAATTGTGTCATTGAAATCCCCCTTGAAGGGTTGTAGTATTTATCTACAACGAACAAGATAAAAAACCCTTCAAAGGAGGACTTTAA
AATGGATAATATAATAATAAATGAATTATCCAAATATTTCAAGTCAATGATACAAGAAATAATGCTAAGTGAAAGAGAAAAATACTTGAAAGAACACTCA
GAAACAAGAGGGAATGGGTACTACATAAGAACACCTAAAACTATATTGGGCGATATGGAGCTTGAAATACCAAGAACACGTGATGGTAATTTTAAGCCAT
CCATAATTCCAGAGCGGAAAAGAGTTACTTTTATGTTAGATGATGTGATAAGAGCATTGTTTACTGCTGGCTTAAGCTCGAGGAAGACAGGAGAAGTAAT
AAGAAACCTTATGGGTACTTCTGTATCAGCTTCGTTTGTAAGTTCAAATTTAGAGATATCAGAAGAAGTTATAAGTAAATTTATGAATAGAGAACTTACA
GAAAATTATCCTGTAATTTACATAGATGCCACTTATATTTCGTTGAAGAGGGATACCGTATCTAAAGAATCTGTTTATGTTGTGTTAGGTCTTAGTACAG
ATGGCAGACGTGAAATATTGACATATTGTTTACCTGGTGGAGATGAGAAATCATCGGTATGGAGAGATATCTTTATAAATTTGACCAACAGAGGATTGAG
AGGTGTAAAAATGGTCATTAGTGATGATTTACCTGGTATAGGAGAAGTAATTAAAGAAGTATTTCCCAATGCCGACCATCAGCTTTGCTGGTTTCATTTG
AAGAAAAATATTAAGAATAAAGTCAGAAAATCAGATTTTGATGAGATATTAAAAGAATTGGAGTATGTATTTGAATCTAACAACGAAGATGAAGCTAAAA
GTCGGCTACATGCCTTTATCAACAAATGGAGCAAGCTTTATAGATACTTTAATAACTTGAGAGATAAAATAAATAGTTATTGTTACTTTTTTAAATTTCA
TCCTAAATTAAGGAGTTATTTTAGTACCACAAATTGGTTAGAGAGATGTTTTAAGGAACTTAAAGACAATATAAGAATTAGGGGGTATTTTCATTCTGAA
GAGAGTGCAAATAAGTTTTTATATCTATTTTTTAGTGATAAAAGTTTAAAATATCATGAGAGAAAATTAAGGTACTCAAATATAATAGAGGAGACTCTTA
ATGGATAAAAATGCTTCAAGGGTGATGGTTGACACAATTAAGTTGACATTACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1107 bp368 aa1021208+No
ORF function : Transposase
Description :

ORF sequence :

MDNIIINELSKYFKSMIQEIMLSEREKYLKEHSETRGNGYYIRTPKTILGDMELEIPRTRDGNFKPSIIPERKRVTFMLDDVIRALFTAGLSSRKTGEVI
RNLMGTSVSASFVSSNLEISEEVISKFMNRELTENYPVIYIDATYISLKRDTVSKESVYVVLGLSTDGRREILTYCLPGGDEKSSVWRDIFINLTNRGLR
GVKMVISDDLPGIGEVIKEVFPNADHQLCWFHLKKNIKNKVRKSDFDEILKELEYVFESNNEDEAKSRLHAFINKWSKLYRYFNNLRDKINSYCYFFKFH
PKLRSYFSTTNWLERCFKELKDNIRIRGYFHSEESANKFLYLFFSDKSLKYHERKLRYSNIIEETLNG

 

Blast result :
Comments
ISCni1 is 55% aa similar to ISEf1.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Pitluck,S., Sikorski,J., Zeytun,A., Lapidus,A., Nolan,M., Lucas,S., Hammon,N., Deshpande,S., Cheng,J.F., Tapia,R., Han,C., Goodwin,L., Liolios,K., Pagani,I., Ivanova,N., Mavromatis,K., Pati,A., Chen,A., Palaniappan,K., Hauser,L., Chang,Y.J., Jeffries,C.D., Detter,J.C.,
Brambilla,E., Djao,O.D., Rohde,M., Spring,S., Goker,M., Woyke,T., Bristow,J., Eisen,J.A., Markowitz,V., Hugenholtz,P., Kyrpides,N.C., Klenk,H.P. and Land,M. (2011) Stand Genomic Sci 4 (1), 54-62.