ISCcl1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_016627 ND Clostridium clariflavum
Clostridium clariflavum DSM 19732
DNA section
IS Length : 1581 bp

Ends


IR Length : 12/23

IRL : GAGGCTGTAAAAAATTTTGTGTATGGATGAGTAAGTGTTCTCCTTCTTGG
IRR : GGAGTATAAATAATTCTGTGTATCGGAATTTATGTAATCCTTCTTTAGCA

Insertion site


Left flankDirect repeatRight flankDR Length
ATCCCTCAAGCTATTTTACATAAAGTTTG9

DNA sequence

GAGGCTGTAAAAAATTTTGTGTATGGATGAGTAAGTGTTCTCCTTCTTGGCAAGAATTAATAAAAGAAAATGCTAAGGAGGAGAATTTTATGTCAACACT
ATCGAAAGAACATGTAAAACAATTAGTTCGGGAAAATAATTTCAAAAGTGTATCCGATGTAAATGCTTATCTAAAGGACATTTTTAAAGATATTATTCAG
GAGCTGCTTGAGGCAGAACTTGAAGCAAAATTAGGGTATGCCAAAGATGATATTGAAAGTAAGAATACCGACAATAGTCGTAACGGTTATACTCCAAAGA
CCATAAAAAGTGAATTTGGAGAAGTTGATATACAAGTACCAAGAGATCGCAAAGGAGAGTTTAAACCAAAAATCATCCCTAAATATCAGCGTGATGTTTC
TGGAATTGAAGAAAAAGTTATAGCTCTATATGCAAGAGGAATGTCTACAAGGGATATCAGTCAACAAATTGAAGATCTTTATGGATTTAGCCTGTCGGCT
GAGATGGTTAGTAAGATTACTGATAGAATTGCTCCAGAAATTAAGGAATGGCAACAAAGGCCGCTTGAGCCTATATACTCTTTTATCTTTATGGATGCAA
TTCATTATAAGGTTAGGGATAATGGAAGAGTAGTAAACCGGGCAGCTTATGTAGTTCTAGGTGTTACTATTGATGGATATAAAGATATCTTAGGTATATG
GATTGGTGAGAATGAATCCTCGAAATTTTGGCTTGGAGTGCTAAATGACCTTAAAAACAGAGGAATACAGGATGTTTTAATCTTCTGTGTTGATGGACTT
ACCGGACTTAAGGAAGCGATAAATGCTGCATATCCAAAAGCTGAAGTACAGCGCTGCATAATACATCAACTGAGAAATTCCTTTAAATACGTGCCATATA
AAGACCTAAAGGCTTTTAGTAATGATTTCAAAGAAGTATATCATGCCATTAATGAGGAAGTGGCATTAGATAAGCTATATGAGCTTAAAGATAAGTGGGG
AAAGGAATATCCTTATGCAATACGTAGTTGGGAAAATAACTGGGAGGTAATAAGCCCGTTTTTCAAATTTACAGAAGAAATAAGAAGAATAATTTATACT
ACAAATATAATTGAAGGACTGCATCGTCAGTTCCGTAAGGTAACAAAATCAAAATCAATATTCCCAACAGACAGTTCACTAGAAAAAATGTTGTATTTAG
CATCAATGAATGTAGTGAAGAAATGGACACAGCGTTATAAAAACTGGGATAGAGTGCTTAGCGAATTGATGATTCAATACGAGGGTAGGTTGGAAAGCTA
TATTTAAAAGCATTCACCCCCACCGCCCTAAAGGGCTCGTCCTCATTGCCGGACGGGCTAGACCTCACAAAATTAAAAACATGGGCTCAAAACACAAATA
ATACCCATTATGAATAATTATTGCCAGAATTAATCAAGTTTATGTATAAAACTTAATAAATCCGGCAATAATATACAATATAAAGGTAATATAGAGTCAC
ATTCTGTAAACCTTGTCAACTTGAATGTACTTGCTAAAGAAGGATTACATAAATTCCGATACACAGAATTATTTATACTCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1218 bp405 aa901307+No
ORF function : Transposase
Description :

ORF sequence :

MSTLSKEHVKQLVRENNFKSVSDVNAYLKDIFKDIIQELLEAELEAKLGYAKDDIESKNTDNSRNGYTPKTIKSEFGEVDIQVPRDRKGEFKPKIIPKYQ
RDVSGIEEKVIALYARGMSTRDISQQIEDLYGFSLSAEMVSKITDRIAPEIKEWQQRPLEPIYSFIFMDAIHYKVRDNGRVVNRAAYVVLGVTIDGYKDI
LGIWIGENESSKFWLGVLNDLKNRGIQDVLIFCVDGLTGLKEAINAAYPKAEVQRCIIHQLRNSFKYVPYKDLKAFSNDFKEVYHAINEEVALDKLYELK
DKWGKEYPYAIRSWENNWEVISPFFKFTEEIRRIIYTTNIIEGLHRQFRKVTKSKSIFPTDSSLEKMLYLASMNVVKKWTQRYKNWDRVLSELMIQYEGR
LESYI

 

Blast result :
Comments
ISCcl1 is 85% aa similar to ISTwi1.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Kitzmiller,T., Lynd,L., Izquierdo,J. and Woyke,T. (2012) Direct submission GenBank.