ISAtu7

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_010929 ND Agrobacterium tumefaciens
Agrobacterium tumefaciens Ti plasmid pTiBo542
DNA section
IS Length : 1472 bp

Ends


Left end : TATCGGGCATGTTGCCATCGGCGCTCCACGAACGCTCGGCAATCCTATCCTGTCATGTTAGAATTGTCGTGTCGGGACAGGGGCGTCGGAGTGCGAAGAA
Right end : GCACAGGCGGAGGCAGCCTACGCAGCTATGGTCGAAGCCTGGAGAGATAGGCCACCTAAACCACAAAAAGGCTGAGAAAGGGGCTGTTCAACAACATCCG

Insertion site


Left flankDirect repeatRight flankDR Length
GCTATGTTGTTATCGATTTC0

DNA sequence

TATCGGGCATGTTGCCATCGGCGCTCCACGAACGCTCGGCAATCCTATCCTGTCATGTTAGAATTGTCGTGTCGGGACAGGGGCGTCGGAGTGCGAAGAA
GCGGGCAGGCCGAATTGACTTTGAGCTGCGAGCTCGCGTTGTTATCTGGCCGCCCCTGCGACTATCCCGTCTGCGCTGCGAGCGCGTATCCGTAGATGTC
GCCCAGCCCGCGCACTCTCCCATTAACAACATGGAGGATTGTGAATGCGGTCGATCGGAATGGATGTACATCGAAGTTTTGCGCAGGTCGCGGTTCTTGA
CCGGGGCAAGGTCACAGAAGAATTCCGGGTGGAACTGGATTACGACGCTGTGGTGGCCTTTGGGCAGAAGCTTCGAGAAGATGACGAAGTTATACTGGAA
GCGACCGGGAACACCTCGGCCATCGTAAGGTTGCTGACGCCTTTCGTGGCCAAGGTCGTTATCGCGAACCCGCTTCAGGTGAAGGCCATCGCCCACGCGC
GCGTGAAGACCGACAAAGTCGACGCGAGGATTCTAGCGCAGCTTCATGCCGCCGGCTTTTTGCCAGAGGTCTGGGCCGCGGATGACGATACCCTGAACCT
GCGTCGTCTCGTCTCGGAGCGCGCGGCGCTCGTGCGATCAGTGCGACGGGTGAAGAGCAGGGTCCAAGCCGTTCTCCACGCCAATCTCGTGCCGAAATAC
TCGGGACATCTGTTCGGAAAAGGCGGCAGGGACTGGCTCTCGACGGCCCCGTTGCCCAGGGCAGAGCGCGACCTCCTCGCCCGCCATCTCGATGAACTGG
ACTGGCTGAAGGGCAAGCTTGAAAAGCTGGATGGCACCATGGCGCGAATTGCGCTCGACGACACTCGCACGCGCAAGCTGATGACGATCGCCGGAATAAA
TTCTGTGGTTGCCACGGCGGTGATAGCCGCCATTGGCGACATCTCCCGGTTCCCGACGCCCGACCGGCTTGCGAGCTACTTCGGCTTGACCCCGCGGGTG
CGCCAGTCCGGCGATCGCGGGGCAATCCATGGCCGCATCTCGAAACAGGGAAATGCGATTGCCAGAACGATGCTGATTGAAGCTGCCTGGTCGGCCGCGT
CGGTTCCGGGGCCGCTGCGTGCCTTCTTTCTCCGGATTAAGGACCGCAAAGGCCTCAACGTCGCGGCGGTCGCAACGGCGCGCAAGATCGCAAATCTGAT
CTGGGAGTTGCTGACCAAGGAAGCTCCCTACAGATGGGCTCGGCCCGCCTTTGTTGCCATGAAGATGCGCAAGCTTGAACTGCGTGCCGGCGCAGCCAAA
GCACATGGGCCAGCTGGTCCCGCCCGCGATTACTGGATCAAGGAAATCCGCCATCGAGAGATGGAGCTCGTTGCACAGGCGGAGGCAGCCTACGCAGCTA
TGGTCGAAGCCTGGAGAGATAGGCCACCTAAACCACAAAAAGGCTGAGAAAGGGGCTGTTCAACAACATCCG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1188 bp395 aa2601447+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MDVHRSFAQVAVLDRGKVTEEFRVELDYDAVVAFGQKLREDDEVILEATGNTSAIVRLLTPFVAKVVIANPLQVKAIAHARVKTDKVDARILAQLHAAGF
LPEVWAADDDTLNLRRLVSERAALVRSVRRVKSRVQAVLHANLVPKYSGHLFGKGGRDWLSTAPLPRAERDLLARHLDELDWLKGKLEKLDGTMARIALD
DTRTRKLMTIAGINSVVATAVIAAIGDISRFPTPDRLASYFGLTPRVRQSGDRGAIHGRISKQGNAIARTMLIEAAWSAASVPGPLRAFFLRIKDRKGLN
VAAVATARKIANLIWELLTKEAPYRWARPAFVAMKMRKLELRAGAAKAHGPAGPARDYWIKEIRHREMELVAQAEAAYAAMVEAWRDRPPKPQKG

 

Blast result :
Comments
ISAtu7 is 45% aa similar to ISMma5.
References
1] Oger,P.M., Farrand,S.K., Olsen,G.J. and Reich,C.(2005) Direct submission GenBank.

2] ISfinder annotation (2009)