ISAzo26

  • Family IS91
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006513 ND Azoarcus sp.
Aromatoleum aromaticum EbN1
Azoarcus sp. EbN1
Azoarcus sp. EbN1 plasmid 2
DNA section
IS Length : 2604 bp

Ends


oriIS : TGGACTAAACCGCTGGCGCGGTAGGGGGTGATCCACGCGCGGTGCCGAAGCCGGCACATTCCCACAAAGCCCGCGTTGGAGAAGGATGGGGTGGCTGTTC II struct. : No
terIS : GCCTACCGAACGCGGTCATCCCGGAGCGCCCGCATCAGCACCTGCTCGCCGCGTTCGCCAGGCTAAAAACCCTCTGCATTATCCTCGGTCAACTATTAGG II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site

DNA sequence

TGGACTAAACCGCTGGCGCGGTAGGGGGTGATCCACGCGCGGTGCCGAAGCCGGCACATTCCCACAAAGCCCGCGTTGGAGAAGGATGGGGTGGCTGTTC
GCAGCCCTTCGTTCCTTCCCAATCAGGAGCTTTGCCATGACACCCCTTCGCCAGCGCATGCTCGAAGACATGGGCGTTCGCAATCTCGCCCCGAACACCC
AGTCGGCCTACCTGAAGCAAGTCTCCGCCTATGCAAGGTACTTCGATTGCTCGCCCGACGAACTCGGGCCGGAGCAGGTTCGCGCCTATCAGGTCTATCT
GACGCAGACCCGCAAACTCACCCCCTCCACGGTCAGTGTCGCGACCGGCGCGCTGCGATTTCTCTACAAGGTGACACTCAAGCGCGCCTGGGCGGTGGAA
GAGATTCCAATGCCCAAGCGGTCCTTCAAGCTCCCGGTGGTACTGAGCCGCGAAGAGGTGTCGCAGTTCCTGGCGTCGGTCGACCATCTCATGCATCGCA
CGATCCTGATGACGGCCTATGCCGCCGGGCTGCGCGTCTCGGAAGCGACCCACCTCAAGGTGAGCGACATCGACAGCCAGCGCATGGTCTTGCGGGTCGA
CCAGGGCAAAGGACGCAAGGATCGCTACGTGATGCTCTCGCCGCGGCTGCTCGAGGCGTTGCGGGTCTACTGGAAGTCCGCGCGGCCAACGCTGTGGCTG
TTTCCGGGTGACGTGCCGGGTCAGCCGATCACCCGCAATGCGGTGGGATTGGCGTGCCAGAAGGCTCGGCGCGCCTGCGGCATTCGGAAACCGATTACCC
CGCACTCGCTTCGACATGCCTTCGCCACACACCTGCTCGAATCCGGCACCGACGTGCGCACCATCCAGTTGCTGCTCGGCCATCGCAGTCTCGCCACGAC
CTCGCGCTACCTGAAGGTCGCCACCAGCACCGTGTGCGCGACGACGAGCCCGTTCGACCTGTTGCCGAAAGTGGTGGTGGATCCGCCGCAGCCGAGTCCG
CCCGTCCATTTCTGAGACCGGGGCGTGCGCGCCACCGGGCTCGAGGTGGCGGACATCTTTCGTCAGGCCGGGCCCATCTATCGCCGGGACCACGCGGCTA
CCCTCAGCCGCGGGCAGTACCAGGTCATGCGCGCGATCGAGCGTTGCCGCACCGCGGCCCTCGGCGGACACGTCGAGCAGTGCGACGCCTGCGGTCACCA
GCGCATCGCGTTCAATAGCTGCCGCAATCGGCACTGTCCCAAATGTCAGTCCCTGGTGCGGGCGCAATGGCTCGAAGCGCGCCAGGCCGATCTGCTCCCC
GTCGAGTATTTCCACGTCGTCTTCACCGTCCCCGAGGACATCGCGGCGATCAGCTATCAGAACAAGAGCGTGGTCTACGAGATCCTGTTTCACGCCACCG
CCGAGACCTTGCGCATCATCGCCGCCGATCCGAGGCACCTCGGGGCCGAGCTCGGTTTCATCGCCATCCTGCATACCTGGGGGCAGAATATGCTGCATCA
CCCGCATCTGCACTGCGTCGTGCCGGGCGGGGGCGTGTCGGCCGACGGCGAGCGCTGGATCGCGTGCCGCCGCGGGTTCTTCCTGCCCGTGCGGGTGCTG
TCGCGGCTGTTCCGGCACCTGTTCCTCAAGCGCTTGCAACAGGCCTTTGATGCGGGCGAGCTCCACTTCTTCAATGCCCTCGCGGCGCTGCACGCGCCCG
CTGTCTTCGCCCGGCATCTGGCGCGCGCGAGACGATCCGAGTGGGTGGTTTTCGCCAAACCGCCGTTCGGCGGCCCGCAGCAGGTCCTCGAATATCTTGG
CCGCTATACCCATCGCGTCGCCATCTCGAACAATCGCCTCGTCGCCTGCACCGACGATGAGGTGAGCTTTCGCTGGAAGGACTACCGCCACCACGGGCGC
AACAAAGTCATGCGCCTGGAGGCGCACGAATTCATCCGCCGCTTCCTGCTGCATGTCCTGCCGGCGGGGTTCCATCGTATCCGGCATTACGGATTTCTCG
CCAACCGCCTTCGCGCGAGCGCGCTCGCCCACTGCCGGGCGTTGCTCAGCGCCCCCGCGCCAGAACCGCAGACCGACGCGCCGCGCGACTACCGTGAGCG
CTACCAGCAGCTCACCGGAAGGTCACTACGCGACTGCCCGCAATGTGGCCGGGGTCACATGGTGTGCCTCGAGACCTTCCTGCCCGGCGCCTTGCCCCGC
GCGCCGCCGCGAGTGCCGTCATGAATGCGACCGCTGCCGATTTCCTGAACGCTTCCCTGGCATCCAAGAGAGGCGCCGGGACTCCTGTCGCCAGGCACGG
CCGAAACCGCCGGAGCGGCTCCGCGTCGTCGGCGCGGTGCTCGCCCGGGCAGCCACCCCAGGCATCCGAAGGCGCCGCAATCATCGCTCGGGCGTCATTT
CCACGAGCCATTCCGGCAGCCATTCACGCCTTCGCCGCTCGCACCACGATTCAATCCCCATAGCCCCACCCGCGTGCCGGCGGTTCAGTCCAACAGGCTT
TTTAGCCTACCGAACGCGGTCATCCCGGAGCGCCCGCATCAGCACCTGCTCGCCGCGTTCGCCAGGCTAAAAACCCTCTGCATTATCCTCGGTCAACTAT
TAGG
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
930 bp309 aa861015+No
ORF function : Accessory Gene
AG : IS91 integrase/resolvase

ORF sequence :

MGWLFAALRSFPIRSFAMTPLRQRMLEDMGVRNLAPNTQSAYLKQVSAYARYFDCSPDELGPEQVRAYQVYLTQTRKLTPSTVSVATGALRFLYKVTLKR
AWAVEEIPMPKRSFKLPVVLSREEVSQFLASVDHLMHRTILMTAYAAGLRVSEATHLKVSDIDSQRMVLRVDQGKGRKDRYVMLSPRLLEALRVYWKSAR
PTLWLFPGDVPGQPITRNAVGLACQKARRACGIRKPITPHSLRHAFATHLLESGTDVRTIQLLLGHRSLATTSRYLKVATSTVCATTSPFDLLPKVVVDP
PQPSPPVHF

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1200 bp399 aa10252224+No
ORF function : Transposase
Chemistry : Y2

ORF sequence :

VRATGLEVADIFRQAGPIYRRDHAATLSRGQYQVMRAIERCRTAALGGHVEQCDACGHQRIAFNSCRNRHCPKCQSLVRAQWLEARQADLLPVEYFHVVF
TVPEDIAAISYQNKSVVYEILFHATAETLRIIAADPRHLGAELGFIAILHTWGQNMLHHPHLHCVVPGGGVSADGERWIACRRGFFLPVRVLSRLFRHLF
LKRLQQAFDAGELHFFNALAALHAPAVFARHLARARRSEWVVFAKPPFGGPQQVLEYLGRYTHRVAISNNRLVACTDDEVSFRWKDYRHHGRNKVMRLEA
HEFIRRFLLHVLPAGFHRIRHYGFLANRLRASALAHCRALLSAPAPEPQTDAPRDYRERYQQLTGRSLRDCPQCGRGHMVCLETFLPGALPRAPPRVPS

 

Blast result :
Comments
ISAzo26 is 58%(orfA) aa similar to ISSod25 and 56%(orfB, the transposase) aa similar to ISWz1.
References
1] Kuhner,S., Wohlbrand,L., Fritz,I., Wruck,W., Hultschig,C., Hufnagel,P., Kube,M., Reinhardt,R. and Rabus,R. (2005) J. Bacteriol. 187 (4), 1493-1503.

2] Rabus,R., Kube,M., Heider,J., Beck,A., Heitmann,K., Widdel,F. and Reinhardt,R. (2005) Arch. Microbiol. 183 (1), 27-36.

3] PROSCIENCE (2004) Direct Submission GenBank.

4] ISfinder annotation (2008).